CHMP1A Monoclonal antibody, PBS Only (Capture)

CHMP1A Monoclonal Antibody for Indirect ELISA, Cytometric bead array
Cat No. 68862-3-PBS
Clone No.1G11A12

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

Cytometric bead array, Indirect ELISA

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68862-3-PBS targets CHMP1A as part of a matched antibody pair:

MP50256-2: 68862-3-PBS capture and 68862-4-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity Human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8376

Product name: Recombinant human CHMP1A protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-196 aa of BC007527

Sequence: MDDTLFQLKFTAKQLEKLAKKAEKDSKAEQAKVKKALLQKNVECARVYAENAIRKKNEGVNWLRMASRVDAVASKVQTAVTMKGVTKNMAQVTKALDKALSTMDLQKVSSVMDRFEQQVQNLDVHTSVMEDSMSSATTLTTPQEQVDSLIMQIAEENGLEVLDQLSQLPEGASAVGESSVRSQEDQLSRRLAALRN

Predict reactive species
Full Name chromatin modifying protein 1A
Calculated Molecular Weight 196 aa, 22 kDa
GenBank Accession NumberBC007527
Gene Symbol CHMP1A
Gene ID (NCBI) 5119
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G Magarose purification
UNIPROT IDQ9HD42
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...