Product Information
68913-3-PBS targets CD28 as part of a matched antibody pair:
MP50331-2: 68913-3-PBS capture and 68913-4-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24058 Product name: Recombinant human CD28 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 180-220 aa of BC093698 Sequence: RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS Predict reactive species |
| Full Name | CD28 molecule |
| Calculated Molecular Weight | 220 aa, 25 kDa |
| GenBank Accession Number | BC093698 |
| Gene Symbol | CD28 |
| Gene ID (NCBI) | 940 |
| ENSEMBL Gene ID | ENSG00000178562 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G Magarose purification |
| UNIPROT ID | P10747 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
