PSIP1 Monoclonal antibody, PBS Only (Detector)

PSIP1 Monoclonal Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA
Cat No. 68941-1-PBS
Clone No.1C4G5

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA

CLL associated antigen KW 7, CLL-associated antigen KW-7, DFS70, LEDGF, Lens epithelium-derived growth factor

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68941-1-PBS targets PSIP1 as part of a matched antibody pair:

MP50375-1: 67723-1-PBS capture and 68941-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag21886

Product name: Recombinant human PSIP1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 104-324 aa of BC064135

Sequence: ASSDVEVEEKETSVSKEDTDHEEKASNEDVTKAVDITTPKAARRGRKRKAGVVTTATASVNLKVSPKRGRPAATEVKIPKPRGRPKMVKQPCPSESDIITEEDKSKKKGQEEKQPKKQPKKDEEGQKEEDKPRKEPDKKEGKKEVESKRKNLAKTGVTSTSDSEEEGDDQEGEKKRKGGRNFQTAHRRNMLKGQHEKEAADRKRKQEEQMETEHQTTCNLQ

Predict reactive species
Full Name PC4 and SFRS1 interacting protein 1
Calculated Molecular Weight 530 aa, 60 kDa
GenBank Accession NumberBC064135
Gene Symbol PSIP1
Gene ID (NCBI) 11168
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO75475
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PSIP1, also known as PC4 and SRSF1 Interacting Protein 1 or Lens Epithelium-Derived Growth Factor (LEDGF), is a transcriptional coactivator involved in neuroepithelial stem cell differentiation and neurogenesis. It also plays a role in lens epithelial cell gene regulation and stress responses. It is a chromatin-associated protein with histone chaperone activity, involved in transcriptional elongation. PSIP1 may act as an adapter to coordinate pre-mRNA splicing. PSIP1 encodes two protein isoforms with molecular masses of 52 and 75 kDa. p52 and p75 were identified as interacting with transcription factor PC4 and shown to act as transcriptional coactivators.

Loading...
||
New chat Able
正在加载,请稍候...