HMGCR Monoclonal antibody, PBS Only (Capture)

HMGCR Monoclonal Antibody for Cytometric bead array, Indirect ELISA
Cat No. 68976-1-PBS
Clone No.1F12C2

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68976-1-PBS targets HMGCR as part of a matched antibody pair:

MP50438-2: 68976-1-PBS capture and 68975-3-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag29287

Product name: Recombinant human HMGCR protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 536-835 aa of BC033692

Sequence: TRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGRNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHLVKSHMIHNRSKINLQDLQGACTKKTA

Predict reactive species
Full Name 3-hydroxy-3-methylglutaryl-Coenzyme A reductase
Calculated Molecular Weight 888 aa, 95 kDa
GenBank Accession NumberBC033692
Gene Symbol HMGCR
Gene ID (NCBI) 3156
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP04035
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...