Nanog Recombinant monoclonal antibody, PBS Only (Capture)

Nanog Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, Cytometric bead array, Sandwich ELISA, Indirect ELISA
Cat No. 80210-13-PBS
Clone No.250067F10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Cytometric bead array, Sandwich ELISA, Indirect ELISA

hNanog

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

80210-13-PBS targets Nanog as part of a matched antibody pair:

MP02157-2: 80210-13-PBS capture and 80210-12-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag5645

Product name: Recombinant human NANOG protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-305 aa of BC160187

Sequence: MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNMQPEDV

Predict reactive species
Full Name Nanog homeobox
Calculated Molecular Weight 35 kDa
Observed Molecular Weight35-40 kDa
GenBank Accession NumberBC160187
Gene Symbol Nanog
Gene ID (NCBI) 79923
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9H9S0
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Nanog is a member of the homeobox family of DNA binding transcription factors and has been shown to maintain embryonic stem (ES) cell self-renewal independently of leukemia inhibitory factor (LIF)/Stat3. Nanog mRNA is present in pluripotent mouse and human cell lines, and absent from differentiated cells. Functionally, Nanog works together with other key pluripotent factors (Oct4, Sox2, and Lin28) to reprogram human fibroblasts and generate induced pluripotent stem (iPS) cells. These key factors form a regulatory network to support or limit each other's expression level, which maintains the properties of ES cells. There are two kinds of variants that can be recognized by NANOG, one is a normal form (~39 kDa), the other is a post-translation modified form (~48 kDa) (21136380 ). Nanog has two isoforms with molecular weights of 34.4 kDa and 31.9 kDa. (PMID: 21969378)

Loading...
||
New chat Able
正在加载,请稍候...