• Featured Product
  • KD/KO Validated

p38 MAPK Recombinant monoclonal antibody

p38 MAPK Uni-rAb® Recombinant Antibody for WB, FC (Intra), IP, ELISA
Cat No. 80821-3-RR
Clone No.230263H7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, FC (Intra), IP, ELISA

MAPK14, 230263H7, CSAID-binding protein, CSBP, CSBP1

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, HepG2 cells, mouse brain tissue, HeLa cells, HEK-293 cells, A549 cells, PC-12 cells, RAW.264.7 cells
Positive IP detected inHEK-293 cells
Positive FC (Intra) detected inHeLa cells, Jurkat cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

80821-3-RR targets p38 MAPK in WB, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag5115

Product name: Recombinant human p38 MAPK protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-307 aa of BC031574

Sequence: MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAY

Predict reactive species
Full Name mitogen-activated protein kinase 14
Calculated Molecular Weight 360 aa, 41 kDa
Observed Molecular Weight38-42 kDa
GenBank Accession NumberBC031574
Gene Symbol p38 MAPK
Gene ID (NCBI) 1432
RRIDAB_3670490
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ16539
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MAPK14(mitogen-activated protein kinase 14) is also named as SAPK2A, p38MAPK, CSBP1, RK, p38, EXIP, Mxi2, CSBP2, PRKM14, PRKM15, CSPB1, p38ALPHA and belongs to the MAP kinase subfamily. MAPK14-signaling is a central pathway for the integration of instructive signals in dendritic cells for T(H)17 differentiation and inflammation(PMID:22231518). It plays an important role in the regulation of hematopoietic stem cell self-renewal in vitro and inhibition of MAPK14 activation with a small molecule inhibitor may represent a novel approach to promote ex vivo expansion of hematopoietic stem cell(PMID:21198398). This protein has 4 isoforms produced by alternative splicing.

Protocols

Product Specific Protocols
WB protocol for p38 MAPK antibody 80821-3-RRDownload protocol
IP protocol for p38 MAPK antibody 80821-3-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...