Tested Applications
| Positive WB detected in | HeLa cells, HEK-293 cells, MCF-7 cells, MOLT-4 cells, Jurkat cells, Raji cells, NIH/3T3 cells, HSC-T6 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC-Autostainer detected in | human colon tissue |
| Positive IF/ICC detected in | HepG2 cells, TNF alpha treated HT-1080 cells |
| Positive FC (Intra) detected in | HepG2 cells |
| Positive ChIP-qPCR detected in | hTNF (30 ng/ml, 1 h) HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:40000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC)-AUTOSTAINER | IHC-AUTOSTAINER : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:125-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| CHIP-QPCR | CHIP-QPCR : 1:10-1:100 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
80979-1-RR targets NF-κB p65 in WB, IHC-Autostainer, IF/ICC, FC (Intra), IP, CoIP, ELISA, ChIP-qPCR applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, chicken, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag1199 Product name: Recombinant human p65; RELA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-220 aa of BC011603 Sequence: MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQ Predict reactive species |
| Full Name | v-rel reticuloendotheliosis viral oncogene homolog A (avian) |
| Calculated Molecular Weight | 65 kDa |
| Observed Molecular Weight | 65 kDa |
| GenBank Accession Number | BC011603 |
| Gene Symbol | NF-κB p65 |
| Gene ID (NCBI) | 5970 |
| RRID | AB_2918923 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q04206 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Nuclear factor kB (NF-kB) is a sequence-specific DNA-binding protein complex which regulates the expression of viral genomes, including the human immunodeficiency virus, and a variety of cellular genes, particularly those involved in immune and inflammatory responses. The members of the NF-kB family in mammalian cells include the proto-oncogene c-Rel,p50/p105 (NFkB1), p65 (RelA), p52/p100 (NFkB2), and RelB. All of these proteins share a conserved 300-amino acid region known as the Rel homology domain which is responsible for DNA binding, dimerization, and nuclear translocation of NF-kB. The p65 subunit is a major component of NF-kB complexes and is responsible for trans-activation. NF-kB heterodimeric p65-p50 and p65-c-Rel complexes are transcriptional activators. The NF-kB p65-p65 complex appears to be involved in invasin-mediated activation of IL-8 expression. The inhibitory effect of IkB upon NF-kB the cytoplasm is exerted primarily through the interaction with p65. p65 shows a weak DNA-binding site which could contribute directly to DNA binding in the NF-kB complex. It associates with chromatin at the NF-kB promoter region via association with DDX1. This antibody is a rabbit monoclonal antibody raised against residues near the N terminus of human RELA.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for NF-κB p65 antibody 80979-1-RR | Download protocol |
| IF protocol for NF-κB p65 antibody 80979-1-RR | Download protocol |
| IP protocol for NF-κB p65 antibody 80979-1-RR | Download protocol |
| WB protocol for NF-κB p65 antibody 80979-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
NF-κB p65 Recombinant monoclonal antibody (4C7), catalog number 80979-1-RR, has accumulated 442 total citations. These publications appear in journals including Nature Communications, Nature Microbiology, Advanced Science, Science Advances, Biomaterials, Journal of Ethnopharmacology, Phytomedicine, Cell Reports, Theranostics, and Free Radical Biology and Medicine. Research fields span NF-κB/inflammatory signaling, oncology, neurodegeneration, cardiovascular disease, liver pathology, immunology, nanomedicine, metabolic disorders, and traditional Chinese medicine pharmacology.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Chimeric antigen receptor with novel intracellular modules improves antitumor performance of T cells | ||
Signal Transduct Target Ther Innovative peptide-loaded hybrid membrane nanovaccine enables precise personalized immunotherapy for HPV-related cervical diseases. | ||
Exploration (Beijing) Caffeic Acid Acts as a Potent Senomorphic and Alleviates Inflammation and Lung Fibrosis by Covalently Targeting Annexin A5 Protein in Mice. | ||
Adv Mater Multifunctional Injectable Hydrogel as a Biomimic Lens: Optical-Mechanical Restoration and Dynamic Postoperative Microenvironment Regulation. | ||
J Natl Cancer Cent S100A8 promotes tumor progression by inducing phenotypic polarization of microglia through the TLR4/IL-10 signaling pathway in glioma | ||
Cell Mol Immunol SPT6 maintains epidermal homeostasis by inhibiting an NF-κB-positive feedback loop to prevent excessive inflammation. |
