SNAI1 Recombinant monoclonal antibody, PBS Only (Capture)

SNAI1 Uni-rAb® Recombinant Antibody for IF/ICC, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA
Cat No. 81584-4-PBS
Clone No.240164C2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA

240164C2, SLUGH 2, SLUGH2, SNAI 1, SNAIL1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

81584-4-PBS targets SNAI1 as part of a matched antibody pair:

MP00343-2: 81584-4-PBS capture and 81584-3-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag24248

Product name: Recombinant human SNAI1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 22-164 aa of BC012910

Sequence: LQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLPMLIWDSVLAPQAQPIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSSLEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYL

Predict reactive species
Full Name snail homolog 1 (Drosophila)
Calculated Molecular Weight 264 aa, 29 kDa
GenBank Accession NumberBC012910
Gene Symbol SNAI1
Gene ID (NCBI) 6615
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO95863
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...