Tested Applications
| Positive WB detected in | mouse spleen tissue, mouse lung tissue |
| Positive IHC detected in | mouse spleen tissue, mouse lung tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | LPS and Brefeldin A treated RAW 264.7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
82854-8-RR targets Mmp9 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with mouse samples.
| Tested Reactivity | mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg0452 Product name: Recombinant Mouse MMP-9 protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 20-730 aa of NM_013599 Sequence: APYQRQPTFVVFPKDLKTSNLTDTQLAEAYLYRYGYTRAAQMMGEKQSLRPALLMLQKQLSLPQTGELDSQTLKAIRTPRCGVPDVGRFQTFKGLKWDHHNITYWIQNYSEDLPRDMIDDAFARAFAVWGEVAPLTFTRVYGPEADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGAGVQGDAHFDDDELWSLGKGVVIPTYYGNSNGAPCHFPFTFEGRSYSACTTDGRNDGTPWCSTTADYDKDGKFGFCPSERLYTEHGNGEGKPCVFPFIFEGRSYSACTTKGRSDGYRWCATTANYDQDKLYGFCPTRVDATVVGGNSAGELCVFPFVFLGKQYSSCTSDGRRDGRLWCATTSNFDTDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPLYSYLEGFPLNKDDIDGIQYLYGRGSKPDPRPPATTTTEPQPTAPPTMCPTIPPTAYPTVGPTVGPTGAPSPGPTSSPSPGPTGAPSPGPTAPPTAGSSEASTESLSPADNPCNVDVFDAIAEIQGALHFFKDGWYWKFLNHRGSPLQGPFLTARTWPALPATLDSAFEDPQTKRVFFFSGRQMWVYTGKTVLGPRSLDKLGLGPEVTHVSGLLPRRLGKALLFSKGRVWRFDLKSQKVDPQSVIRVDKEFSGVPWNSHDIFQYQDKAYFCHGKFFWRVSFQNEVNKVDHEVNQVDDVGYVTYDLLQCP Predict reactive species |
| Full Name | matrix metallopeptidase 9 |
| Calculated Molecular Weight | 81kd |
| Observed Molecular Weight | 92-100 kDa |
| GenBank Accession Number | NM_013599 |
| Gene Symbol | Mmp9 |
| Gene ID (NCBI) | 17395 |
| RRID | AB_3670580 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P41245-1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Mmp9 (matrix metallopeptidase 9), also known as Clg4b. It is expected to be located inextracellular matrix. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, tissue remodeling, and disease processes, such as arthritis or metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. Studies in rhesus monkeys suggest that MMP9 is involved in IL-8-induced mobilization hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling. The pro-MMP9 is 92 kDa, and it can be detected a processed form of 68 kDa. This protein can exist as a dimer of 180 kDa (PMID:7492685).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Mmp9 antibody 82854-8-RR | Download protocol |
| IHC protocol for Mmp9 antibody 82854-8-RR | Download protocol |
| WB protocol for Mmp9 antibody 82854-8-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Mmp9 Recombinant monoclonal antibody (Cat# 82854-8-RR) has 13 citations. These appear in journals including J Nanobiotechnology, Cell Death & Disease, Phytomedicine, Advanced Healthcare Materials, Journal of Orthopaedic Translation, Environmental Health, International Immunopharmacology, Scientific Reports, Cell Signaling, Animal Model and Experimental Medicine, Molecular Biology Reports, Biochemical and Biophysical Research Communications, and Translational Cancer Research. Research fields span cancer (gastric, breast, bladder, glioma), osteoarthritis, bone homeostasis, wound healing, thrombus resolution, and endometrial receptivity, with applications mainly in WB and IHC.
| Species | Application | Title |
|---|---|---|
J Nanobiotechnology Engineered T cell membrane coated nanoparticles reverse thermo-resistance and reprogram tumor microenvironment to synergistically potentiate bladder cancer photothermal immunotherapy. | ||
Cell Death Dis SP-1-activated LINC01016 overexpression promotes gastric cancer invasion and metastasis through inhibiting EIF4A3-mediated MMP9 mRNA decay | ||
Phytomedicine Quercetin targets IL6/JAK1/STAT3/MMP9 signaling to attenuate breast cancer progression in diabetic comorbidity: A multi-omics and experimental study. | ||
Adv Healthc Mater Peptide-Enhanced Bioactive Hydrogel Combined with Photodynamic-Phage Synergistic Antibacterial Therapy System Accelerates Infected Wound Healing | ||
J Orthop Translat Txnip regulates glycolysis and tricarboxylic acid cycle balance to maintain bone homeostasis.
| ||
Environ Health (Wash) Microcystin-LR Impairs Endometrial Receptivity during the Peri-Implantation Window via Disruption of STAT3/HIF-1α Signaling. |
