HLA-DMA Recombinant monoclonal antibody, PBS Only (Capture)

HLA-DMA Uni-rAb® Recombinant Antibody for Cytometric bead array, Indirect ELISA
Cat No. 82899-5-PBS
Clone No.230155F5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

D6S222E, DMA, DMA protein, DMA protein MHC class II antigen Major histocompatibility complex, class II, DM alpha cDNA FLJ75740, highly similar to Homo sapiens major histocompatibility complex, class II, DM alpha, hCG_2001572

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82899-5-PBS targets HLA-DMA as part of a matched antibody pair:

MP00018-1: 82899-5-PBS capture and 82899-1-PBS detection (validated in Cytometric bead array)

MP00018-2: 82899-5-PBS capture and 82899-4-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2452

Product name: Recombinant human HLA-DMA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 21-261 aa of BC026279

Sequence: LPHSWAVPEAPTPMWPDDLQNHTFLHTVYCQDGSPSVGLSEAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKIPVSRGFPIAEVFTLKPLEFGKPNTLVCFVSNLFPPMLTVNWQHHSVPVEGFGPTFVSAVDGLSFQAFSYLNFTPEPSDIFSCIVTHEIDRYTAIAYWVPRNALPSDLLENVLCGVAFGLGVLGIIVGIVLIIYFRKPCSGD

Predict reactive species
Full Name major histocompatibility complex, class II, DM alpha
Calculated Molecular Weight 261 aa, 29 kDa
GenBank Accession NumberBC026279
Gene Symbol HLA-DMA
Gene ID (NCBI) 3108
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ31604
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...