BAZ2A Recombinant monoclonal antibody, PBS Only (Capture)

BAZ2A Uni-rAb® Recombinant Antibody for Cytometric bead array, Indirect ELISA
Cat No. 82910-4-PBS
Clone No.230205F12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

hWALp3, KIAA0314, TIP5, TTF I interacting protein 5, WALp3

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82910-4-PBS targets BAZ2A as part of a matched antibody pair:

MP01313-2: 82910-4-PBS capture and 82910-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag33963

Product name: Recombinant human BAZ2A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 97-295 aa of NM_013449.4

Sequence: QYPSANPGSNLKDPPLLSQFSGGQYPLNGILGGSRQPSSPSHNTNLRAGSQEFWANGTQSPMGLNFDSQELYDSFPDQNFEVMPNGPPSFFTSPQTSPMLGSSIQTFAPSQEVGSGIHPDEAAEKEMTSVVAENGTGLVGSLELEEEQPELKMCGYNGSVPSVESLHQEVSVLVPDPTVSCLDDPSHLPDQLEDTPILS

Predict reactive species
Full Name bromodomain adjacent to zinc finger domain, 2A
Calculated Molecular Weight211 kDa
GenBank Accession NumberNM_013449.4
Gene Symbol BAZ2A
Gene ID (NCBI) 11176
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9UIF9
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

BAZ2A (bromodomain adjacent to zinc finger domain 2A), also known as TIP5. It is expected to be located in nucleus, and the protein is expressed at moderate levels in most tissues analyzed, including heart, brain, placenta, lung, skeletal muscle, kidney and pancreas. BAZ2A is an epigenetic regulator affecting transcription of ribosomal RNA, it is also a regulatory subunit of the ATP-dependent NoRC-1 and NoRC-5 ISWI chromatin remodeling complexes, which form ordered nucleosome arrays on chromatin and facilitate access to DNA during DNA-templated processes such as DNA replication, transcription, and repair (PubMed:28801535). The calculated molecular weight of BAZ2A is 210 kDa.

Loading...
||
New chat Able
正在加载,请稍候...