Product Information
83040-3-PBS targets Betacellulin as part of a matched antibody pair:
MP00138-1: 83040-3-PBS capture and 83040-2-PBS detection (validated in Sandwich ELISA)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Affinity | KD=1.77 x 10-9M KOff=2.71 x 10-4M KOn=1.53 x 105M |
| Immunogen |
CatNo: Ag26724 Product name: Recombinant human BTC protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 32-118 aa of BC011618 Sequence: DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQ Predict reactive species |
| Full Name | betacellulin |
| Calculated Molecular Weight | 20 kDa |
| GenBank Accession Number | BC011618 |
| Gene Symbol | BTC |
| Gene ID (NCBI) | 685 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P35070 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |

