GABRA2 Recombinant monoclonal antibody, PBS Only (Capture/Detector)

GABRA2 Uni-rAb® Recombinant Antibody for WB, FC (Intra), Cytometric bead array, Indirect ELISA
Cat No. 83057-2-PBS
Clone No.230158E6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, FC (Intra), Cytometric bead array, Indirect ELISA

230158E6, GABA(A) receptor subunit alpha-2, GABAAR subunit alpha-2, Gamma-aminobutyric acid receptor subunit alpha-2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83057-2-PBS targets GABRA2 as part of a matched antibody pair:

MP00067-2: 83057-3-PBS capture and 83057-2-PBS detection (validated in Cytometric bead array)

MP00067-3: 83057-2-PBS capture and 83057-4-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag29301

Product name: Recombinant human GABRA2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 348-412 aa of NM_000807

Sequence: SVVNDKKKEKASVMIQNNAYAVAVANYAPNLSKDPVLSTISKSATTPEPNKKPENKPAEAKKTFN

Predict reactive species
Full Name gamma-aminobutyric acid (GABA) A receptor, alpha 2
Calculated Molecular Weight 51 kDa
Observed Molecular Weight50-51 kDa
GenBank Accession NumberNM_000807
Gene Symbol GABRA2
Gene ID (NCBI) 2555
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP47869
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

GABRA2 (gamma-aminobutyric acid type A receptor subunit alpha2), also known as DEE78. It is expected to be located in cell membrane, and the protein is highly expressed in brain. The protein is a ligand-gated chloride channel, which is a component of the heteropentameric receptor for GABA, the major inhibitory neurotransmitter in the brain (PubMed:29961870). It also plays an important role in the formation of functional inhibitory GABAergic synapses in addition to mediating synaptic inhibition as a GABA-gated ion channel (PubMed:29961870). The calculated molecular weight of GABRA2 is 51 kDa.

Loading...
||
New chat Able
正在加载,请稍候...