GABRA2 Recombinant monoclonal antibody

• 

  WB analysis using 83057-2-RR

  mouse cerebellum tissue were subjected to SDS PAGE followed by western blot with 83057-2-RR (GABRA2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 83057-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83057-2-RR (GABRA2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  FC experiment of HeLa using 83057-2-RR

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug GABRA2 Recombinant antibody (83057-2-RR, Clone:230158E6) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

• 

  Affinity and Kinetic Characterization of 83057-2-RR

  Biolayer interferometry (BLl) kinetic assays of 83057-2-RR against Human GABRA2 were performed. The affinity constant is 0.403 nM.

GABRA2 Uni-rAb^® Recombinant Antibody for WB, FC (Intra), ELISA

Cat No. 83057-2-RR

Clone No.230158E6

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, FC (Intra), ELISA

Synonyms

230158E6

---

Tested Applications

• Positive WB detected in: mouse cerebellum tissue, mouse brain tissue, rat brain tissue
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

83057-2-RR targets GABRA2 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag29301

  Product name: Recombinant human GABRA2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 348-412 aa of NM_000807

  Sequence: SVVNDKKKEKASVMIQNNAYAVAVANYAPNLSKDPVLSTISKSATTPEPNKKPENKPAEAKKTFN

• Full Name: gamma-aminobutyric acid (GABA) A receptor, alpha 2
• Calculated Molecular Weight: 51 kDa
• Observed Molecular Weight: 50-51 kDa
• GenBank Accession Number: NM_000807
• Gene Symbol: GABRA2
• Gene ID (NCBI): 2555
• RRID: AB_3670783
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P47869
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GABRA2 (gamma-aminobutyric acid type A receptor subunit alpha2), also known as DEE78. It is expected to be located in cell membrane, and the protein is highly expressed in brain. The protein is a ligand-gated chloride channel, which is a component of the heteropentameric receptor for GABA, the major inhibitory neurotransmitter in the brain (PubMed:29961870). It also plays an important role in the formation of functional inhibitory GABAergic synapses in addition to mediating synaptic inhibition as a GABA-gated ion channel (PubMed:29961870). The calculated molecular weight of GABRA2 is 51 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	J Ethnopharmacol; Flavonoids from mulberry leaves exhibit sleep-improving effects via regulating GABA and 5-HT receptors; Authors - Rui Li
rat	WB	Int Immunopharmacol; Promotion of sleep by cinnamic acid in parachlorophenylalanine-induced insomnia in rats; Authors - Xiaona Ye