GBX2 Recombinant monoclonal antibody, PBS Only (Capture/Detector)

GBX2 Uni-rAb® Recombinant Antibody for Cytometric bead array, Indirect ELISA
Cat No. 83145-4-PBS
Clone No.230468G8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Gastrulation and brain-specific homeobox protein 2, Homeobox protein GBX-2

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83145-4-PBS targets GBX2 as part of a matched antibody pair:

MP00200-1: 83145-2-PBS capture and 83145-4-PBS detection (validated in Cytometric bead array)

MP00200-2: 83145-3-PBS capture and 83145-4-PBS detection (validated in Cytometric bead array)

MP00200-3: 83145-4-PBS capture and 83145-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag16288

Product name: Recombinant human GBX2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 65-248 aa of BC137448

Sequence: LPQAALQPALPPAHPHHQIPSLPTGFCSSLAQGMALTSTLMATLPGGFSASPQHQEAAAARKFAPQPLPGGGNFDKAEALQADAEDGKGFLAKEGSLLAFSAAETVQASLVGAVRGQGKDESKVEDDPKGKEESFSLESDVDYSSDDNLTGQAAHKEEDPGHALEETPPSSGAAGSTTSTGKNR

Predict reactive species
Full Name gastrulation brain homeobox 2
Calculated Molecular Weight 348 aa, 37 kDa
GenBank Accession NumberBC137448
Gene Symbol GBX2
Gene ID (NCBI) 2637
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP52951
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...