TRIM54 Recombinant monoclonal antibody, PBS Only (Detector)

TRIM54 Uni-rAb® Recombinant Antibody for WB, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA
Cat No. 83175-2-PBS
Clone No.230391G5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

230391G5, MuRF3, MuRF-3, Muscle-specific RING finger protein, Muscle-specific RING finger protein 3

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83175-2-PBS targets TRIM54 as part of a matched antibody pair:

MP00236-3: 83175-1-PBS capture and 83175-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag15229

Product name: Recombinant human TRIM54 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 178-358 aa of BC141807

Sequence: IAMLVAGNDRVQAVITQMEEVCQTIEDNSRRQKQLLNQRFESLCAVLEERKGELLQALAREQEEKLQRVRGLIRQYGDHLEASSKLVESAIQSMEEPQMALYLQQAKELINKVGAMSKVELAGRPEPGYESMEQFTVRVEHVAEMLRTIDFQPGASGEEEEVAPDGEEGSAGPEEERPDGP

Predict reactive species
Full Name tripartite motif-containing 54
Calculated Molecular Weight 358 aa, 40 kDa
Observed Molecular Weight40 kDa
GenBank Accession NumberBC141807
Gene Symbol TRIM54
Gene ID (NCBI) 57159
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9BYV2
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

TRIM54 (Tripartite motif-containing protein 54) is also names as MURF, MURF3, RNF30. The expression of TRIM54 is required for skeletal myoblast differentiation and myotube fusion. It is expressed in heart and skeletal muscle specifically (PMID:11243782). It has two isoforms with the molecular weight of 40KDa and 45KDa. It can be dimerizated and hetero-dimerizated to form homooligomer and heterooligomer (PMID:15967462).

Loading...
||
New chat Able
正在加载,请稍候...