Tested Applications
Positive WB detected in | HeLa cells, HepG2 cells, Jurkat cells, mouse kidney tissue |
Positive IF/ICC detected in | A431 cells |
Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:50000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
83276-1-RR targets Cytochrome c in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag1455 Product name: Recombinant human Cytochrome c protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-105 aa of BC009578 Sequence: MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE Predict reactive species |
Full Name | cytochrome c, somatic |
Calculated Molecular Weight | 12 kDa |
Observed Molecular Weight | 12-15 kDa |
GenBank Accession Number | BC009578 |
Gene Symbol | Cytochrome c |
Gene ID (NCBI) | 54205 |
RRID | AB_3670946 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purfication |
UNIPROT ID | P99999 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Cytochrome c is a 12-15 kDa electron transporting protein located in the inner mitochondrial membrane. As a part of respiratory chain, cytochrome c plays a critical role in the process of oxidative phosphorylation and ATP producing. Besides, cytochrome c also gets implicated in apoptosis process. Upon apoptotic stimulation, cytochrome c can be released from mitochondria into cytoplasm, which is required for caspase-3 activation and the occurrence of apoptosis.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Cytochrome c antibody 83276-1-RR | Download protocol |
IF protocol for Cytochrome c antibody 83276-1-RR | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |