NOD2 Recombinant monoclonal antibody, PBS Only (Detector)

NOD2 Uni-rAb® Recombinant Antibody for IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA
Cat No. 83281-3-PBS
Clone No.230327E10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

230327E10, CARD15, Caspase recruitment domain-containing protein 15, Nucleotide-binding oligomerization domain-containing protein 2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83281-3-PBS targets NOD2 as part of a matched antibody pair:

MP00320-1: 83281-1-PBS capture and 83281-3-PBS detection (validated in Cytometric bead array)

MP00320-2: 83281-4-PBS capture and 83281-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag33771

Product name: Recombinant human NOD2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 30-216 aa of NM_001293557

Sequence: SQEAFQAQRSQLVELLVSGSLEGFESVLDWLLSWEVLSWEDYEGFHLLGQPLSHLARRLLDTVWNKGTWACQKLIAAAQEAQADSQSPKLHGCWDPHSLHPARDLQSHRPAIVRRLHSHVENMLDLAWERGFVSQYECDEIRLPIFTPSQRARRLLDLATVKANGLAAFLLQHVQELPVPLALPLEA*

Predict reactive species
Full Name nucleotide-binding oligomerization domain containing 2
Calculated Molecular Weight 115 kDa
GenBank Accession NumberNM_001293557
Gene Symbol NOD2
Gene ID (NCBI) 64127
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9HC29
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

NOD2, also named as CARD15 and IBD1, induces NF-kappa-B via RICK (CARDIAK, RIP2) and IKK-gamma. It confers responsiveness to intracellular bacterial lipopolysaccharides (LPS). Defects in NOD2 are the cause of Blau syndrome (BS). Defects in NOD2 are a cause of susceptibility to Crohn disease (CD). Defects in NOD2 are a cause of susceptibility to ulcerative colitis. Defects in NOD2 are the cause of early-onset sarcoidosis (EOS).

Loading...
||
New chat Able
正在加载,请稍候...