COPS8 Recombinant monoclonal antibody, PBS Only (Detector)

COPS8 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 83312-1-PBS
Clone No.240195B1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

COP9, 240195B1, COPS8/COP9, CSN8, hCOP9

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83312-1-PBS targets COPS8 as part of a matched antibody pair:

MP00336-2: 83312-2-PBS capture and 83312-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0143

Product name: Recombinant human COPS8 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 14-194 aa of BC003090

Sequence: KKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNE

Predict reactive species
Full Name COP9 constitutive photomorphogenic homolog subunit 8 (Arabidopsis)
Calculated Molecular Weight 23 kDa
Observed Molecular Weight23 kDa
GenBank Accession NumberBC003090
Gene Symbol COPS8
Gene ID (NCBI) 10920
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ99627
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

COPS8 is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases.

Loading...
||
New chat Able
正在加载,请稍候...