SAT1 Recombinant monoclonal antibody, PBS Only (Capture)

SAT1 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), Sandwich ELISA, Indirect ELISA
Cat No. 83319-1-PBS
Clone No.240157G2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, FC (Intra), Sandwich ELISA, Indirect ELISA

240157G2, EC:2.3.1.57, Polyamine N-acetyltransferase 1, SAT, Spermidine/spermine N(1)-acetyltransferase 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83319-1-PBS targets SAT1 as part of a matched antibody pair:

MP00344-4: 83319-1-PBS capture and 83319-3-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1154

Product name: Recombinant human SAT1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-171 aa of BC008424

Sequence: MAKFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE

Predict reactive species
Full Name spermidine/spermine N1-acetyltransferase 1
Calculated Molecular Weight 20 kDa
Observed Molecular Weight 15-25 kDa
GenBank Accession NumberBC008424
Gene Symbol SAT1
Gene ID (NCBI) 6303
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP21673
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Spermidine/spermine N1-acetyltransferase 1 (SAT1 or SSAT1) is the key regulatory enzyme in the catabolism of polyamines, catalyzing acetylation of spermidine or spermine to generate N1-acetyl spermidine or N1-acetyl spermine, and N1, N12-diacetylspermine. The cellular level of SAT1 is normally extremely low, but it is induced rapidly by a variety of stimuli, including polyamines, polyamine analogs, toxic chemicals, certain drugs, and growth factors. Downregulation of SAT1 has been reported in Epstein-Barr virus positive Burkitt's lymphoma cells.

Loading...
||
New chat Able
正在加载,请稍候...