Mouse IL-1RA Recombinant monoclonal antibody, PBS Only (Detector)

IL-1RA Uni-rAb® Recombinant Antibody for Cytometric bead array, Indirect ELISA
Cat No. 83335-1-PBS
Clone No.240208A11

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

Cytometric bead array, Indirect ELISA

Il1rn, IL-1RN, IL 1ra, Interleukin-1

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83335-1-PBS targets IL-1RA as part of a matched antibody pair:

MP00353-1: 83335-2-PBS capture and 83335-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0685

Product name: Recombinant mouse IL-1RN protein

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 8-159 aa of NM_031167.5

Sequence: RPSGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNIKLEEKIDMVPIDLHSVFLGIHGGKLCLSCAKSGDDIKLQLEEVNITDLSKNKEEDKRFTFIRSEKGPTTSFESAACPGWFLCTTLEADRPVSLTNTPEEPLIVTKFYFQEDQ

Predict reactive species
Full Name interleukin 1 receptor antagonist
Calculated Molecular Weight18KD
GenBank Accession NumberNM_031167.5
Gene Symbol IL-1RA 
Gene ID (NCBI) 16181
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ542W1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The interleukin-1 receptor antagonist (IL-1RN) belongs to the IL-1 family. L1RN is a protein that binds to IL1 receptors, and inhibits the binding of IL1-alpha and IL1-beta.

Loading...
||
New chat Able
正在加载,请稍候...