Use Able AI chat for product recommendations

POLR2H Recombinant monoclonal antibody, PBS Only (Detector)

POLR2H Uni-rAb® Recombinant Antibody for WB, Indirect ELISA, Cytometric bead array

Cat No. 83439-1-PBS
Clone No.240410F9

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB, Indirect ELISA, Cytometric bead array

hsRPB8, hRPB8, DNA-directed RNA polymerases I, II, and III subunit RPABC3, DNA-directed RNA polymerases I, II, and III 17.1 kDa polypeptide, DNA-directed RNA polymerase II subunit H

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83439-1-PBS targets POLR2H as part of a matched antibody pair:

MP00447-1: 83439-2-PBS capture and 83439-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity Human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag7166

Product name: Recombinant human POLR2H protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-150 aa of BC000739

Sequence: MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF

Predict reactive species
Full Name polymerase (RNA) II (DNA directed) polypeptide H
Calculated Molecular Weight 17 kDa
GenBank Accession NumberBC000739
Gene Symbol POLR2H
Gene ID (NCBI) 5437
RRIDAB_3671080
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP52434
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

POLR2H, also known as hRPB8, is a 150 amino acid protein, which localizes in nucleolus and is expressed in 228 organ(s), highest expression level in mucosa of transverse colon. POLR2H. POLR2H is a DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. POLR2H is a common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively

Loading...
||
New chat

Able

正在加载,请稍候...