MDC1 Recombinant monoclonal antibody, PBS Only (Detector)

MDC1 Uni-rAb® Recombinant Antibody for WB, IF/ICC, Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 83496-1-PBS
Clone No.240469D5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

240469D5, MDC 1, NFBD 1, NFBD1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83496-1-PBS targets MDC1 as part of a matched antibody pair:

MP00487-1: 83496-5-PBS capture and 83496-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag20135

Product name: Recombinant human MDC1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-350 aa of BC152556

Sequence: MEDTQAIDWDVEEEEETEQSSESLRCNVEPVGRLHIFSGAHGPEKDFPLHLGKNVVGRMPDCSVALPFPSISKQHAEIEILAWDKAPILRDCGSLNGTQILRPPKVLSPGVSHRLRDQELILFADLLCQYHRLDVSLPFVSRGPLTVEETPRVQGETQPQRLLLAEDSEEEVDFLSERRMVKKSRTTSSSVIVPESDEEGHSPVLGGLGPPFAFNLNSDTDVEEGQQPATEEASSAARRGATVEAKQSEAEVVTEIQLEKDQPLVKERDNDTKVKRGAGNGVVPAGVILERSQPPGEDSDTDVDDDSRPPGRPAEVHLERAQPFGFIDSDTDAEEERIPATPVVIPMKKR

Predict reactive species
Full Name mediator of DNA damage checkpoint 1
Calculated Molecular Weight 2089 aa, 227 kDa
GenBank Accession NumberBC152556
Gene Symbol MDC1
Gene ID (NCBI) 9656
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ14676
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

MDC1, also named as KIAA0170 or NFBD1, is a 2089 amino acid protein, which contains two BRCT domains and one FHA domain. MDC1 localizes in the nucleus and is highly expressed in testis. MDC1 is required for checkpoint mediated cell cycle arrest in response to DNA damage within both the S phase and G2/M phases of the cell cycle. MDC1 may serve as a scaffold for the recruitment of DNA repair and signal transduction proteins to discrete foci of DNA damage marked.

Loading...
||
New chat

Able

正在加载,请稍候...