S100A14 Recombinant monoclonal antibody, PBS Only

S100A14 Uni-rAb® Recombinant Antibody for Cytometric bead array, Indirect ELISA
Cat No. 83559-4-PBS
Clone No.240528G11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Protein S100 A14, Protein S100-A14, S100 calcium-binding protein A14, S100A15, S114

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83559-4-PBS targets S100A14 as part of a matched antibody pair:

MP00547-2: 83559-1-PBS capture and 83559-4-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0757

Product name: Recombinant human S100A14 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-104 aa of BC005019

Sequence: MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH

Predict reactive species
Full Name S100 calcium binding protein A14
Calculated Molecular Weight 12 kDa
GenBank Accession NumberBC005019
Gene Symbol S100A14
Gene ID (NCBI) 57402
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9HCY8
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...