• Featured Product
  • KD/KO Validated

RCN1 Recombinant monoclonal antibody, PBS Only (Detector)

RCN1 Uni-rAb® Recombinant Antibody for WB, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA
Cat No. 83638-3-PBS
Clone No.240473E9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

Reticulocalbin 1, 240473E9, PIG20, RCAL, RCN

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83638-3-PBS targets RCN1 as part of a matched antibody pair:

MP00637-3: 83638-4-PBS capture and 83638-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag13256

Product name: Recombinant human RCN1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-272 aa of BC010120

Sequence: MARGGRGRRLGLALGLLLALVLAPRVLRAKPTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHW

Predict reactive species
Full Name reticulocalbin 1, EF-hand calcium binding domain
Calculated Molecular Weight 39 kDa
Observed Molecular Weight 44-46 kDa
GenBank Accession NumberBC010120
Gene Symbol RCN1
Gene ID (NCBI) 5954
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ15293
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Reticulocalbin-1 (RCN1) belongs to the CREC family. Reticulocalbin‐1, an endoplasmic reticulum protein, plays a crucial role in calcium homeostasis and inhibits ER stress‐induced apoptosis (PMID: 28319095). Its main functions include maintaining intracellular homeostasis and regulating cell proliferation and apoptosis, and it plays an important role in the development of various tumours (PMID: 38057406). RCN1 is expressed aberrantly and at a high level in various tumors, including acute myeloid leukemia (AML) (PMID: 37746742). In multiple cancers, such as glioblastoma, non‐small cell lung cancer, renal cell carcinoma, hepatocellular carcinoma, and oral squamous cell carcinoma, the overexpression of RCN1 has been observed indicating its involvement in tumorigenesis and invasion (PMID: 30172915, PMID: 34722631).

Loading...
||
New chat Able
正在加载,请稍候...