PTPN4 Recombinant monoclonal antibody, PBS Only (Capture)

PTPN4 Uni-rAb® Recombinant Antibody for WB, IHC, Cytometric bead array, Indirect ELISA
Cat No. 83695-1-PBS
Clone No.240739A11

Host / Isotype

Rabbit / IgG

Reactivity

human, rat, pig

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

240739A11, EC:3.1.3.48, Protein-tyrosine phosphatase MEG1, PTN4, PTPase-MEG1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83695-1-PBS targets PTPN4 as part of a matched antibody pair:

MP00680-1: 83695-1-PBS capture and 83695-2-PBS detection (validated in Cytometric bead array)

MP00680-2: 83695-1-PBS capture and 83695-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, rat, pig
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1585

Product name: Recombinant human PTPN4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 604-927 aa of BC010674

Sequence: NAVYDVVEEKLENEPDFQYIPEKAPLDSVHQDDHSLRESMIQLAEGLITGTVLTQFDQLYRKKPGMTMSCAKLPQNISKNRYRDISPYDATRVILKGNEDYINANYINMEIPSSSIINQYIACQGPLPHTCTDFWQMTWEQGSSMVVMLTTQVERGRVKCHQYWPEPTGSSSYGCYQVTCHSEEGNTAYIFRKMTLFNQEKNESRPLTQIQYIAWPDHGVPDDSSDFLDFVCHVRNKRAGKEEPVVVHCSAGIGRTGVLITMETAMCLIECNQPVYPLDIVRTMRDQRAMMIQTPSQYRFVCEAILKVYEEGFVKPLTTSTNK

Predict reactive species
Full Name protein tyrosine phosphatase, non-receptor type 4 (megakaryocyte)
Calculated Molecular Weight 106 kDa
Observed Molecular Weight106 kDa
GenBank Accession NumberBC010674
Gene Symbol PTPN4
Gene ID (NCBI) 5775
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP29074
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PTPN4 is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This protein contains a C-terminal PTP domain and an N-terminal domain homologous to the band 4.1 superfamily of cytoskeletal-associated proteins. This PTP has been shown to interact with glutamate receptor delta 2 and epsilon subunits, and is thought to play a role in signalling downstream of the glutamate receptors through tyrosine dephosphorylation.

Loading...
||
New chat Able
正在加载,请稍候...