IL-7Ra/CD127 Recombinant monoclonal antibody, PBS Only (Capture)

IL-7Ra/CD127 Uni-rAb® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 83723-3-PBS
Clone No.240749C2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

CD127, IL 7 receptor subunit alpha, IL 7R alpha, IL 7R subunit alpha, IL 7RA

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83723-3-PBS targets IL-7Ra/CD127 as part of a matched antibody pair:

MP00704-3: 83723-3-PBS capture and 83723-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1279

Product name: Recombinant Human IL-7RA/CD127 protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 21-239 aa of AAC83204.1

Sequence: ESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNTTNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVIYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSSGEMD

Predict reactive species
Full Name interleukin 7 receptor
Calculated Molecular Weight52 kDa
GenBank Accession NumberAAC83204.1
Gene Symbol CD127
Gene ID (NCBI) 3575
ENSEMBL Gene IDENSG00000168685
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP16871-1(I66T, V138I)
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat

Able

正在加载,请稍候...