NRAS Recombinant monoclonal antibody

NRAS Uni-rAb® Recombinant Antibody for WB, IHC, ELISA
Cat No. 83815-2-RR
Clone No.242810G11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

HRAS1, EC:3.6.5.2, GTPase NRas, N ras, NRAS1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, A549 cells, HEK-293 cells, MCF-7 cells, Jurkat cells, NIH/3T3 cells, C6 cells
Positive IHC detected inmouse testis tissue, mouse pancreas tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83815-2-RR targets NRAS in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1081

Product name: Recombinant human NRAS protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-189 aa of BC005219

Sequence: MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM

Predict reactive species
Full Name neuroblastoma RAS viral (v-ras) oncogene homolog
Calculated Molecular Weight 21 kDa
Observed Molecular Weight 21 kDa
GenBank Accession NumberBC005219
Gene Symbol NRAS
Gene ID (NCBI) 4893
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP01111
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NRAS, also named as N-ras and NRAS1, is neuroblastoma RAS viral (v-ras) oncogene homolog from the mammalian ras gene family and it is a member of the small GTPase superfamily. RAS proteins are involved in signal transduction pathways, and bind GDP/GTP and possess intrinsic GTPase activity. It is mapped on chromosome 1, and it is activated in HL60, a promyelocytic leukemia line. Defects in NRAS are a cause of juvenile myelomonocytic leukemia (JMML). NRAS is one member of RAS gene family of oncoproteins, which is commonly mutated in melanoma and hematopoietic cancers via mapped on chromosome 1 (PMID: 2327491, PMID: 26990546). NRAS mediates activation of both mitogen-activated protein kinase (MAPK) and PI3K/AKT/MYC signaling (PMID: 17297468). NRAS induced classical MAPK signaling leads to cyclin D1 expression and cell cycle dysregulation and promotion of prosurvival pathways (PMID:7970723,PMID: 18246127). In addition, NRAS effectively prevents Glycogen Synthase Kinase3 (GSK3)-mediated phosphorylation of MYC via PI3K/AKT, which results in enhanced activity of endogenous MYC protein (PMID: 17297468). Mutational NRAS causes Ras-GTP to be in a state of continuous activation, which results in malignant proliferation and metastasis (PMID: 24985059).

Protocols

Product Specific Protocols
WB protocol for NRAS antibody 83815-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...