Home
Products
Primary Antibodies
Recombinant Antibodies
Cathepsin B Recombinant monoclonal antibody, PBS Only (Capture) (83998-4-PBS)

Cathepsin B Recombinant monoclonal antibody, PBS Only (Capture)

Name: Cathepsin B Recombinant monoclonal antibody, PBS Only (Capture), 100ug
Brand: Proteintech
SKU: 83998-4-PBS-100UG

Cathepsin B Uni-rAb^® Recombinant Antibody for WB, IP, Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 83998-4-PBS

Clone No.260854C10

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, Cytometric bead array, Sandwich ELISA, Indirect ELISA

Synonyms

CTSB, APP secretase, APPS, Cat B, Cathepsin B heavy chain

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBSandwich ELISA sample testSandwich ELISAIPCytometric bead array sample testCytometric bead array

WB analysis using 83998-4-RR (same clone as 83998-4-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 83998-4-RR (Cathepsin B antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83998-4-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Sandwich ELISA sample test of MP03489-1
Urine of six individual healthy human donors was measured. The Cathepsin B concentration of detected samples was determined to be 1.64 ng/mL with a range of 0.76-2.39 ng/mL.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Sandwich ELISA sample test of MP03489-1
Saliva of six individual healthy human donors was measured. The Cathepsin B concentration of detected samples was determined to be 186.38 ng/mL with a range of 146.98-271.31 ng/mL.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Sandwich ELISA sample test of MP03489-1
Human milk of six individual healthy human donors was measured. The Cathepsin B concentration of detected samples was determined to be 150.72 ng/mL with a range of 95.82-192.06 ng/mL.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Sandwich ELISA sample test of MP03489-1
Plasma of six individual healthy human donors was measured. The Cathepsin B concentration of detected samples was determined to be 65.00 ng/mL with a range of 32.20-170.78 ng/mL.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Sandwich ELISA standard curve of MP03489-1
Sandwich ELISA standard curve of MP03489-1, Human Cathepsin B Recombinant Matched Antibody Pair - PBS only. 83998-4-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg1020. 83998-5-PBS was HRP conjugated as the detection antibody. Range: 0.781-50 ng/mL.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IP experiment of HepG2 using 83998-4-RR (same clone as 83998-4-PBS)
IP result of anti-Cathepsin B (IP:83998-4-RR, 4ug; Detection:83998-4-RR 1:600) with HepG2 cells lysate 1280 ug. This data was developed using the same antibody clone with 83998-4-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Cytometric bead array sample test of MP03489-1
The mean Cathepsin B concentration was determined to be 41.1 ng/mL in human plasma.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Cytometric bead array standard curve of MP03489-1
Cytometric bead array standard curve of MP03489-1, Cathepsin B Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 83998-4-PBS. Detection antibody: 83998-5-PBS. Standard: Eg1020. Range: 0.078-10 ng/mL.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

83998-4-PBS targets Cathepsin B as part of a matched antibody pair:

MP03489-1: 83998-4-PBS capture and 83998-5-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Eg1020 Product name: Recombinant human Cathepsin B protein Source: mammalian cells-derived, pHZ-KIsec-C-6HIS Tag: C-10His Domain: 18-339 aa of NM_001908.5 Sequence: RSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI Predict reactive species
Full Name	cathepsin B
Calculated Molecular Weight	38kDa
Observed Molecular Weight	31 kDa, 43 kDa
GenBank Accession Number	NM_001908.5
Gene Symbol	Cathepsin B
Gene ID (NCBI)	1508
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	P07858
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

CTSB(Cathepsin B) is also named as CPSB and belongs to the peptidase C1 family. It participates in intracellular degradation and turnover of proteins. Cathepsin B precursors found in human malignant ascites fluid do not possess mannose-rich carbohydrates suggesting that a defect in the post translational processing of carbohydrate moieties on tumor. Cathepsin B exists as both glycosylated and unglycosylated forms(PMID:1637335). In rat macrophages and hepatocytes pro- cathepsin B is 39 kDa (unglycosylated =35 kDa), whereas in human fibroblasts procathepsin B is 44.5-46kDa (unglycosylated=39kDa)(PMID:2097084). It can be detected the 43 kDa form of pro-CTSB, 31 kDa and 25 kDa mature forms in mouse brain by western blot(PMID:20616152).