EXOC1 Recombinant monoclonal antibody, PBS Only (Capture/Detector)

EXOC1 Uni-rAb® Recombinant Antibody for Cytometric bead array, Indirect ELISA
Cat No. 84007-3-PBS
Clone No.241058D10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

BM 102, Exocyst complex component 1, Exocyst complex component Sec3, SEC3, SEC3L1

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84007-3-PBS targets EXOC1 as part of a matched antibody pair:

MP00942-1: 84007-3-PBS capture and 84007-1-PBS detection (validated in Cytometric bead array)

MP00942-2: 84007-3-PBS capture and 84007-4-PBS detection (validated in Cytometric bead array)

MP00942-3: 84007-2-PBS capture and 84007-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2303

Product name: Recombinant human EXOC1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 139-488 aa of BC020650

Sequence: MPGTMAEAEDLDGGTLSRQHNCGTPLPVSSEKDMIRQMMIKIFRCIEPELNNLIALGDKIDSFNSLYMLVKMSHHVWTAQNVDPASFLSTTLGNVLVTVKRNFDKCISNQIRQMEEVKISKKSKVGILPFVAEFEEFAGLAESIFKNAERRGDLDKAYTKLIRGVFVNVEKVANESQKTPRDVVMMENFHHIFATLSRLKISCLEAEKKEAKQKYTDHLQSYVIYSLGQPLEKLNHFFEGVEARVAQGIREEEVSYQLAFNKQELRKVIKEYPGKEVKKGLDNLYKKVDKHLCEEENLLQVVWHSMQDEFIRQYKHFEGLIARCYPGSGVTMEFTIQDILDYCSSIAQSH

Predict reactive species
Full Name exocyst complex component 1
Calculated Molecular Weight 894 aa, 102 kDa
GenBank Accession NumberBC020650
Gene Symbol EXOC1
Gene ID (NCBI) 55763
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NV70
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...