• Featured Product
  • KD/KO Validated

TRAPPC4 Recombinant monoclonal antibody, PBS Only (Detector)

TRAPPC4 Uni-rAb® Recombinant Antibody for WB, IF/ICC, IP, Cytometric bead array, Indirect ELISA
Cat No. 84119-3-PBS
Clone No.241158C11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, Cytometric bead array, Indirect ELISA

241158C11, CGI 104, CGI-104, HSPC172, PTD009

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84119-3-PBS targets TRAPPC4 as part of a matched antibody pair:

MP01030-2: 84119-4-PBS capture and 84119-3-PBS detection (validated in Cytometric bead array)

MP01030-3: 84119-1-PBS capture and 84119-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2737

Product name: Recombinant human TRAPPC4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-219 aa of BC010866

Sequence: MAIFSVYVVNKAGGLIYQLDSYAPRAEAEKTFSYPLDLLLKLHDERVLVAFGQRDGIRVGHAVLAINGMDVNGRYTADGKEVLEYLGNPANYPVSIRFGRPRLTSNEKLMLASMFHSLFAIGSQLSPEQGSSGIEMLETDTFKLHCYQTLTGIKFVVLADPRQAGIDSLLRKIYEIYSDFALKNPFYSLEMPIRCELFDQNLKLALEVAEKAGTFGPGS

Predict reactive species
Full Name trafficking protein particle complex 4
Calculated Molecular Weight 219 aa, 24 kDa
Observed Molecular Weight 24 kDa
GenBank Accession NumberBC010866
Gene Symbol TRAPPC4
Gene ID (NCBI) 51399
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9Y296
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Transport protein particle (TRAPP, also known as trafficking protein particle), a multimeric guanine nucleotide-exchange factor, regulates multiple membrane trafficking pathways (PMID: 20966969). TRAPPC4, also known as synbindin, is a core component of the TRAPP complexes and one of the essential subunits for guanine nucleotide exchange factor activity for Rab1 GTPase (PMID: 31794024). Deficiencies in vesicular transport mediated by TRAPPC4 have been associated with severe syndromic intellectual disability (PMID: 31794024).

Loading...
||
New chat Able
正在加载,请稍候...