Mouse IL-1 beta Recombinant monoclonal antibody, PBS Only (Capture)

IL-1 beta Uni-rAb® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 84136-1-PBS
Clone No.241364B3

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

IL 1beta, Il1b, IL 1 beta, Il 1b, IL-1 beta,IL 1 beta,IL1beta

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84136-1-PBS targets IL-1 beta as part of a matched antibody pair:

MP01046-3: 84136-1-PBS capture and 84136-3-PBS detection (validated in Cytometric bead array)

MP01046-4: 84136-1-PBS capture and 84136-6-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1577

Product name: Recombinant Mouse IL-1 beta protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: N-6*His

Domain: 118-269 aa of NM_008361.4

Sequence: VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS

Predict reactive species
Full Name interleukin 1 beta
Calculated Molecular Weight31kDa
GenBank Accession NumberNM_008361.4
Gene Symbol IL-1 beta
Gene ID (NCBI) 16176
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP10749
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...