FAM136A Recombinant monoclonal antibody, PBS Only (Capture)

FAM136A Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA
Cat No. 84150-2-PBS
Clone No.241433D12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

241433D12, Protein FAM136A

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84150-2-PBS targets FAM136A as part of a matched antibody pair:

MP01066-3: 84150-2-PBS capture and 84150-5-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag34058

Product name: Recombinant human FAM136A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-138 aa of BC014975

Sequence: MAELQQLRVQEAVESMVKSLERENIRKMQGLMFRCSASCCEDSQASMKQVHQCIERCHVPLAQAQALVTSELEKFQDRLARCTMHCNDKAKDSIDAGSKELQVKQQLDSCVTKCVDDHMHLIPTMTKKMKEALLSIGK

Predict reactive species
Full Name family with sequence similarity 136, member A
Observed Molecular Weight12 kDa
GenBank Accession NumberBC014975
Gene Symbol FAM136A
Gene ID (NCBI) 84908
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ96C01
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

FAM136A is an evolutively conserved nuclear gene encoding a mitochondrial protein whose specific function is unknown, but which is commonly found in neurosensory epithelial cells, where it plays a role in the electron transport chain of respiration (PMID: 37461313). FAM136A, with a molecular mass of 16-kDa, is normally expressed in the cytoplasm and has been linked to familial Meniere's disease.

Loading...
||
New chat Able
正在加载,请稍候...