GPNMB Recombinant monoclonal antibody, PBS Only (Capture)

GPNMB Uni-rAb® Recombinant Antibody for WB, IF/ICC, Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 84160-3-PBS
Clone No.241435F3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

241435F3, Hematopoietic growth factor inducible neurokinin-1 type, NMB, Osteoactivin, Transmembrane glycoprotein NMB

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84160-3-PBS targets GPNMB as part of a matched antibody pair:

MP01096-1: 84160-3-PBS capture and 84160-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag14124

Product name: Recombinant human GPNMB protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 22-181 aa of BC011595

Sequence: AKRFHDVLGNERPSAYMREHNQLNGWSSDENDWNEKLYPVWKRGDMRWKNSWKGGRVQAVLTSDSPALVGSNITFAVNLIFPRCQKEDANGNIVYEKNCRNEAGLSADPYVYNWTAWSEDSDGENGTGQSHHNVFPDGKPFPHHPGWRRWNFIYVFHTLG

Predict reactive species
Full Name glycoprotein (transmembrane) nmb
Calculated Molecular Weight 64 kDa
Observed Molecular Weight120 kDa, 95 kDa
GenBank Accession NumberBC011595
Gene Symbol GPNMB
Gene ID (NCBI) 10457
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ14956
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

GPNMB also known as HGFIN, osteoactivin, and DC-HIL, is a type I membrane glycoprotein involved in various biological processes, including inflammation, invasion and metastasis of malignant tumors, cell differentiation, and tissue regeneration. GPNMB shows expression in the lowly metastatic human melanoma cell lines and xenografts but does not show expression in the highly metastatic cell lines. GPNMB acts as an osteogenic factor that stimulates osteoblast differentiation in vivo and in vitro.

Loading...
||
New chat Able
正在加载,请稍候...