ATAD1 Recombinant monoclonal antibody, PBS Only (Detector)

ATAD1 Uni-rAb® Recombinant Antibody for Cytometric bead array, Indirect ELISA
Cat No. 84194-2-PBS
Clone No.241449C7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

AFDC1, ATAD 1, ATPase family AAA domain-containing protein 1, EC:7.4.2.-, FNP001

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84194-2-PBS targets ATAD1 as part of a matched antibody pair:

MP01090-1: 84194-4-PBS capture and 84194-2-PBS detection (validated in Cytometric bead array)

MP01090-2: 84194-3-PBS capture and 84194-2-PBS detection (validated in Cytometric bead array)

MP01090-3: 84194-1-PBS capture and 84194-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag10343

Product name: Recombinant human ATAD1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 164-361 aa of BC010868

Sequence: DKWYGESQKLAAAVFSLAIKLQPSIIFIDEIDSFLRNRSSSDHEATAMMKAQFMSLWDGLDTDHSCQVIVMGATNRPQDLDSAIMRRMPTRFHINQPALKQREAILKLILKNENVDRHVDLLEVAQETDGFSGSDLKEMCRDAALLCVREYVNSTSEESHDEDEIRPVQQQDLHRAIEKMKKSKDAAFQNVLTHVCLD

Predict reactive species
Full Name ATPase family, AAA domain containing 1
Calculated Molecular Weight 361 aa, 41 kDa
GenBank Accession NumberBC010868
Gene Symbol ATAD1
Gene ID (NCBI) 84896
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8NBU5
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...