• Featured Product
  • KD/KO Validated

NETO2 Recombinant monoclonal antibody, PBS Only (Capture)

NETO2 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 84222-2-PBS
Clone No.241451E10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Cytometric bead array, Indirect ELISA

241451E10, Brain-specific transmembrane protein containing 2 CUB and 1 LDL-receptor class A domains protein 2, BTCL2, NEOT2, Neuropilin and tolloid-like protein 2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84222-2-PBS targets NETO2 as part of a matched antibody pair:

MP01159-2: 84222-2-PBS capture and 84222-4-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2971

Product name: Recombinant human NETO2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 378-525 aa of BC012381

Sequence: MACKTAFNKTGFQEVFDPPHYELFSLRDKEISADLADLSEELDNYQKMRRSSTASRCIHDHHCGSQASSVKQSRTNLSSMELPFRNDFAQPQPMKTFNSTFKKSSYTFKQGHECPEQALEDRVMEEIPCEIYVRGREDSAQASISIDF

Predict reactive species
Full Name neuropilin (NRP) and tolloid (TLL)-like 2
Calculated Molecular Weight 525 aa, 59 kDa
Observed Molecular Weight59 kDa
GenBank Accession NumberBC012381
Gene Symbol NETO2
Gene ID (NCBI) 81831
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8NC67
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Neuropilin and tolloid-like 2 (NETO2), a member of the subfamily of CUB domain and LDLa-containing proteins, was identified as an auxiliary protein of neuronal kainate receptors (KARs) and played critical roles in regulating the functions of KARs. It was also able to bind to the active oligomeric form of K+-Cl− cotransporter (KCC2) to enhance its recycling in hippocampal neurons. Recently, elevated mRNA levels of NETO2 were detected in several types of tumors.

Loading...
||
New chat Able
正在加载,请稍候...