VDAC2 Recombinant monoclonal antibody, PBS Only (Capture)

VDAC2 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), IP, Cytometric bead array, Indirect ELISA
Cat No. 84225-2-PBS
Clone No.241569G11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, Cytometric bead array, Indirect ELISA

241569G11, FLJ23841, hVDAC2, VDAC 2, VDAC-2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inmouse heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Product Information

84225-2-PBS targets VDAC2 as part of a matched antibody pair:

MP01162-1: 84225-2-PBS capture and 84225-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2266

Product name: Recombinant human VDAC2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-294 aa of BC000165

Sequence: MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELEA

Predict reactive species
Full Name voltage-dependent anion channel 2
Calculated Molecular Weight 294 aa, 32 kDa
Observed Molecular Weight 31-33 kDa
GenBank Accession NumberBC000165
Gene Symbol VDAC2
Gene ID (NCBI) 7417
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP45880
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

VDACs (Voltage Dependent Anion selective Channels), also known as mitochondrial porins, are a family of pore-forming proteins discovered in the mitochondrial outer membrane. Mammals show a conserved genetic organization of the VDAC genes. It's reported that the amount of VDAC transcripts in liver is usually lower than in the other tissues. VDAC2 and especially VDAC3 are highly expressed in testis, while mouse VDAC1 is poorly expressed in this tissue. (PMID: 22020053)

Protocols

Product Specific Protocols
IHC protocol for VDAC2 antibody 84225-2-PBSDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...