NME3 Recombinant monoclonal antibody, PBS Only (Detector)

NME3 Uni-rAb® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA
Cat No. 84278-4-PBS
Clone No.241585G8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84278-4-PBS targets NME3 as part of a matched antibody pair:

MP01200-3: 84278-3-PBS capture and 84278-4-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag7284

Product name: Recombinant human NME3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 22-169 aa of BC000250

Sequence: ERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE

Predict reactive species
Full Name non-metastatic cells 3, protein expressed in
Calculated Molecular Weight 19 kDa
GenBank Accession NumberBC000250
Gene Symbol NME3
Gene ID (NCBI) 4832
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13232
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

NME3 (NME/NM23 Nucleoside Diphosphate Kinase 3), also named as NM23-H3; DR-NM23, is a member of the nucleoside diphosphate kinase (NDPK) family that binds to the mitochondrial outer membrane to stimulate mitochondrial fusion. The depletion of NME3 will cause dysfunction in mitochondrial dynamics. NME3 has been found to facilitate DNA-repair mechanisms binds to several NPHPs, including NEK8, CEP164, and ankyrin repeat and sterile α motif domain-containing 6 (ANKS6).

Loading...
||
New chat Able
正在加载,请稍候...