FAT1 Recombinant monoclonal antibody, PBS Only (Detector)

FAT1 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 84279-3-PBS
Clone No.241602F9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Cytometric bead array, Indirect ELISA

241602F9, CDHF7, FAT, hFat1, ME5

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84279-3-PBS targets FAT1 as part of a matched antibody pair:

MP01192-3: 84279-4-PBS capture and 84279-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag33957

Product name: Recombinant human FAT1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 4390-4550 aa of

Sequence: PSVPLPDIQEFPNYEVIDEQTPLYSADPNAIDTDYYPGGYDIESDFPPPPEDFPAADELPPLPPEFSNQFESIHPPRDMPAAGSLGSSSRNRQRFNLNQYLPNFYPLDMSEPQTKGTGENSTCREPHAPYPPGYQRHFEAPAVESMPMSVYASTASCSDVS

Predict reactive species
Full Name FAT tumor suppressor homolog 1 (Drosophila)
Observed Molecular Weight506-600 kDa, 85 kDa
Gene Symbol FAT1
Gene ID (NCBI) 2195
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ14517
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

FAT1, also known as hFat1, belongs to a member of the cadherin superfamily, has been proposed to play roles in cerebral development, glomerular slit formation, and also to act as a tumor suppressor, but its mechanisms of action have not been elucidated. It is expected to be located in cell membrane and nucleus, which is expressed in many epithelial and some endothelial and smooth muscle cells. The calculated molecular weight of FAT1 is 506 kDa and there is glycosylation modification of the protein. To examine functions of the transmembrane and cytoplasmic domains, they were expressed in HEK-293 and HeLa cells as chimeric proteins in fusion with EGFP and extracellular domains derived from E-cadherin. Proteins comprising the transmembrane domain localized to the membrane fraction (PMID: 15922730, 26373379). The high molecular mass band observed at the expected 500-kDa size of FAT1 is indicated by an arrow together with a prominent band at 85 kDa (PMID: 21680732).

Loading...
||
New chat Able
正在加载,请稍候...