MCTS1 Recombinant monoclonal antibody, PBS Only (Capture)

MCTS1 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 84312-2-PBS
Clone No.241576F2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Cytometric bead array, Indirect ELISA

241576F2, Malignant T-cell-amplified sequence 1, MCT1, MCT-1, Multiple copies T-cell malignancies

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84312-2-PBS targets MCTS1 as part of a matched antibody pair:

MP01214-2: 84312-2-PBS capture and 84312-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag6968

Product name: Recombinant human MCTS1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-181 aa of BC001013

Sequence: MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK

Predict reactive species
Full Name malignant T cell amplified sequence 1
Calculated Molecular Weight 21 kDa
Observed Molecular Weight18-21 kDa
GenBank Accession NumberBC001013
Gene Symbol MCTS1
Gene ID (NCBI) 28985
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9ULC4
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

MCTS1 is an anti-oncogene that plays a role in cell cycle regulation. It can reduce cell doubling time and anchor-dependent growth. The G1 transition time and the duration of the G1 / S transition are shortened. It can also promote the release of deacylated tRNA and mRNA from recycled 40S subunits following ABCE1-mediated dissociation of post-termination ribosomal complexes into subunits (PMID: 10440924).

Loading...
||
New chat Able
正在加载,请稍候...