ALKBH3 Recombinant monoclonal antibody, PBS Only (Capture)

ALKBH3 Uni-rAb® Recombinant Antibody for WB, FC (Intra), Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 84314-2-PBS
Clone No.241650F10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, FC (Intra), Sandwich ELISA, Indirect ELISA, Sample test

241650F10, ABH3, Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3, DEPC 1, DEPC1

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84314-2-PBS targets ALKBH3 as part of a matched antibody pair:

MP01211-2: 84314-2-PBS capture and 84314-4-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2982

Product name: Recombinant human ALKBH3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 148-286 aa of BC015155

Sequence: MEPNPHWHPVLRTLKNRIEENTGHTFNSLLCNLYRNEKDSVDWHSDDEPSLGRCPIIASLSFGATRTFEMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEYHSREPRVNLTFRTVYPDPRGAPW

Predict reactive species
Full Name alkB, alkylation repair homolog 3 (E. coli)
Calculated Molecular Weight 286 aa, 33 kDa
Observed Molecular Weight30-33 kDa
GenBank Accession NumberBC015155
Gene Symbol ALKBH3
Gene ID (NCBI) 221120
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ96Q83
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ALKBH3, also named as ABH3 and DEPC-1, is a dioxygenase that mediates demethylation of DNA and RNA containing 1-methyladenosine (m1A). It has a strong preference for single-stranded. ALKBH3 is requires molecular oxygen, alpha-ketoglutarate and iron. This gene has some isoforms with MW 19-25 kDa and 33 kDa.

Loading...
||
New chat Able
正在加载,请稍候...