Use Able AI chat for product recommendations

EXOSC6 Recombinant monoclonal antibody, PBS Only (Capture)

EXOSC6 Uni-rAb® Recombinant Antibody for IF/ICC, Cytometric bead array, Indirect ELISA

Cat No. 84346-2-PBS
Clone No.241535G9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, Cytometric bead array, Indirect ELISA

MTR3, hMtr3p, hMtr3, exosome component 6, EAP4

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84346-2-PBS targets EXOSC6 as part of a matched antibody pair:

MP01222-1: 84346-2-PBS capture and 84346-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag33513

Product name: Recombinant human EXOSC6 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-272 aa of NM_058219

Sequence: MPGDHRRIRGPEESQPPQLYAADEEEAPGTRDPTRLRPVYARAGLLSQAKGSAYLEAGGTKVLCAVSGPRQAEGGERGGGPAGAGGEAPAALRGRLLCDFRRAPFAGRRRRAPPGGCEERELALALQEALEPAVRLGRYPRAQLEVSALLLEDGGSALAAALTAAALALADAGVEMYDLVVGCGLSLAPGPAPTWLLDPTRLEEERAAAGLTVALMPVLNQVAGLLGSGEGGLTESWAEAVRLGLEGCQRLYPVLQQSLVRAARRRGAAAQP

Predict reactive species
Full Name exosome component 6
Calculated Molecular Weight28kd
Observed Molecular Weight28-32 kDa
GenBank Accession NumberNM_058219
Gene Symbol EXOSC6
Gene ID (NCBI) 118460
RRIDAB_3671886
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ5RKV6
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

EXOSC6 (exosome component 6), also known as p11 or MTR3. The calculated molecular weight of EXOSC6 is 28 kDa. And it has low tissue specificity. The gene product constitutes one of the subunits of the multisubunit particle called exosome, which mediates mRNA degradation. It is also a component of the RNA exosome complex (PMID: 29906447). The composition of human exosome is similar to its yeast counterpart. EXOSC6 is homologous to the yeast Mtr3 protein. Its exact function is not known, however, it has been shown using a cell-free RNA decay system that the exosome is required for rapid degradation of unstable mRNAs containing AU-rich elements (AREs), but not for poly(A) shortening. The exosome does not recognize ARE-containing mRNAs on its own, but requires ARE-binding proteins that could interact with the exosome and recruit it to unstable mRNAs, thereby promoting their rapid degradation.

Loading...
||
New chat

Able

正在加载,请稍候...