ZBP1 Recombinant monoclonal antibody, PBS Only (Detector)

ZBP1 Uni-rAb® Recombinant Antibody for IHC, IF/ICC, Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 84396-2-PBS
Clone No.241582E2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

241582E2, C20orf183, DAI, DLM 1, DLM1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84396-2-PBS targets ZBP1 as part of a matched antibody pair:

MP01267-1: 84396-1-PBS capture and 84396-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag4119

Product name: Recombinant human ZBP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-149 aa of BC028218

Sequence: MAQAPADPGREGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYRMKKELKVSLTSPATWCLGGTDPEGEGPAELALSSPGNCHPGEAGLTLQGASWQWTSTDLSLGSNLNSATWELTGFLSLCLGFFFWLMELTAGLLGRGC

Predict reactive species
Full Name Z-DNA binding protein 1
Calculated Molecular Weight 46 kDa
GenBank Accession NumberBC028218
Gene Symbol ZBP1
Gene ID (NCBI) 81030
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9H171
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ZBP1(Z-DNA-binding protein 1), also named as DAI or DLM-1, is a nucleic acid sensor with some isoforms. It has been reported that ZBP1 can sense the viral nucleic acids of viruses and induce the death of infected cells to prevent virus transmission. ZBP1 can be activated and causes necrocytosis without viral infection, which is associated with nuclear Z-form nucleic acids. ZBP1 can be detected 42 kDa, 55 kDa, 68 kDa isoforms (PMID: 37012234, PMID: 9121465).

Loading...
||
New chat Able
正在加载,请稍候...