NeuN Recombinant monoclonal antibody, PBS Only (Capture)

NeuN antibodies are widely used as neuronal markers to identify and quantify mature neurons in brain and spinal cord tissue in neuroscience research. Proteintech has an extensive range of NeuN antibodies validated for WB, IHC, IF-P, IF-Fro, FC (Intra), ELISA and Dot blot.
Cat No. 84401-1-PBS
Clone No.241461F5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Fox-1 homolog C, FOX3, HRNBP3, NeuN antigen, Neuronal nuclei antigen

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84401-1-PBS targets NeuN as part of a matched antibody pair:

MP01273-2: 84401-1-PBS capture and 84401-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag25689

Product name: Recombinant human NeuN protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-100 aa of NM_001082575

Sequence: MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR

Predict reactive species
Full Name hexaribonucleotide binding protein 3
GenBank Accession NumberNM_001082575
Gene Symbol NeuN
Gene ID (NCBI) 146713
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDA6NFN3
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...