Tested Applications
| Positive WB detected in | LPS and IFN gamma treated THP-1 cells, IFN gamma treated THP-1 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
84427-4-RR targets CXCL9/MIG in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag17932 Product name: Recombinant human CXCL9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 23-125 aa of BC095396 Sequence: TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT Predict reactive species |
| Full Name | chemokine (C-X-C motif) ligand 9 |
| Calculated Molecular Weight | 14 kDa |
| Observed Molecular Weight | 14 kDa |
| GenBank Accession Number | BC095396 |
| Gene Symbol | CXCL9 |
| Gene ID (NCBI) | 4283 |
| RRID | AB_3671954 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q07325 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CXCL9 is a small cytokine known as MIG. CXCL9 is a T-cell chemoattractant, which is induced by IFN-γ. It is closely related to two other CXC chemokines called CXCL10 and CXCL11, whose genes are located near the gene for CXCL9 on human chromosome 4. A high level of CXCL9 revealed in peripheral liquids, can be considered as a marker of host immune response, especially of that involving Th1 cells.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for CXCL9/MIG antibody 84427-4-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CXCL9/MIG Recombinant monoclonal antibody (catalog number 84427-4-RR) has 1 total citation. It appears in the journal Inflammation (2026), in a study titled "RELA as a Diagnostic Biomarker for Parkinson's Disease by Integrating Ferroptosis, Lipid Metabolism, and Neuroinflammation." The associated research field is neuroinflammation and Parkinson's disease, with the antibody applied in Western blot (WB) on human samples.
| Species | Application | Title |
|---|---|---|
Inflammation RELA as a Diagnostic Biomarker for Parkinson's Disease by Integrating Ferroptosis, Lipid Metabolism, and Neuroinflammation. |
