CD55 Recombinant monoclonal antibody

CD55 Uni-rAb® Recombinant Antibody for WB, IHC, ELISA
Cat No. 84519-6-RR
Clone No.241808F7

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IHC, ELISA

Cd55a, Complement decay-accelerating factor, GPI-anchored, Daf, Daf1, DAF-GPI

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse testis tissue, mouse spleen tissue
Positive IHC detected inmouse testis tissue, mouse spleen tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84519-6-RR targets CD55 in WB, IHC, ELISA applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2124

Product name: Recombinant Mouse CD55 protein (rFc Tag)(HPLC verified)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 35-361 aa of NM_010016.3

Sequence: DCGPPPDIPNARPILGRHSKFAEQSKVAYSCNNGFKQVPDKSNIVVCLENGQWSSHETFCEKSCVAPERLSFASLKKEYLNMNFFPVGTIVEYECRPGFRKQPPLPGKATCLEDLVWSPVAQFCKKKSCPNPKDLDNGHINIPTGILFGSEINFSCNPGYRLVGVSSTFCSVTGNTVDWDDEFPVCTEIHCPEPPKINNGIMRGESDSYTYSQVVTYSCDKGFILVGNASIYCTVSKSDVGQWSSPPPRCIEKSKVPTKKPTINVPSTGTPSTPQKPTTESVPNPGDQPTPQKPSTVKVSATQHVPVTKTTVRHPIRTSTDKGEPNT

Predict reactive species
Full Name CD55 antigen
Calculated Molecular Weight43kDa
Observed Molecular Weight55-65 kDa
GenBank Accession NumberNM_010016.3
Gene Symbol CD55
Gene ID (NCBI) 13136
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ61475
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD55, also known as DAF, is a glycosylphosphatidylinositol (GPI)-anchored surface glycoprotein that is widely distributed on blood, stroma, epithelial, and endothelial cells (PMID: 7517044; 29503741). It can also exist as a soluble form in plasma, urine, saliva, tears, and synovial fluids (PMID: 29503741). CD55 is a complement regulatory protein (PMID: 2469439; 7517044). It inhibits formation of the C3 convertases through binding to C3b and C4b. It also binds the alternate pathway convertase C3bBb, the classical pathway convertase and C4b2a to accelerate their decay (PMID: 17289551). CD55 also serves as a receptor for coxsackieviruses B1, B3, and B5 and several enteroviruses (PMID: 7538177; 7517044). The observed molecular weight of mature CD55 varies between 50 to 100 kDa depending on the cell type. Different sizes of CD55 might be caused by alternative splicing or different glycosylation patterns (PMID: 29503741).

Protocols

Product Specific Protocols
IHC protocol for CD55 antibody 84519-6-RRDownload protocol
WB protocol for CD55 antibody 84519-6-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...