RIT2 Recombinant monoclonal antibody, PBS Only (Detector)

RIT2 Uni-rAb® Recombinant Antibody for WB, IHC, Cytometric bead array, Indirect ELISA
Cat No. 84520-1-PBS
Clone No.241916A7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

241916A7, EC:3.6.5.2, GTP binding protein Rit2, GTP-binding protein Rit2, Ras like protein expressed in neurons

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84520-1-PBS targets RIT2 as part of a matched antibody pair:

MP01369-1: 84520-2-PBS capture and 84520-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag3160

Product name: Recombinant human RIT2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-217 aa of BC018060

Sequence: MEVENEASCSPGSASGGSREYKVVMLGAGGVGKSAMTMQFISHQFPDYHDPTIEDAYKTQVRIDNEPAYLDILDTAGQAEFTAMREQYMRGGEGFIICYSVTDRQSFQEAAKFKELIFQVRHTYEIPLVLVGNKIDLEQFRQVSTEEGLSLAQEYNCGFFETSAALRFCIDDAFHGLVREIRKKESMPSLMEKKLKRKDCLWKKLKGSLKKKRENMT

Predict reactive species
Full Name Ras-like without CAAX 2
Calculated Molecular Weight 217 aa, 25 kDa
Observed Molecular Weight 25-28 kDa
GenBank Accession NumberBC018060
Gene Symbol RIT2
Gene ID (NCBI) 6014
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ99578
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

RIT2 (AKA: Rin, Ras-like in neurons) is a small, neuronal, ras-like GTPase with enriched expression in SNc DANs (PMID: 38395968). RIT2 is a member of the Ras superfamily that plays important roles in many vital cellular functions, such as differentiation and survival (PMID: 29860660). Rit2 directly interacts with the DA transporter (DAT), and is required for regulated DAT membrane trafficking. In cell culture models, Rit2 is required for EGF- and NGF-mediated neurite outgrowth, NGF-mediated ERK phosphorylation, and cell viability (PMID: 38395968).

Loading...
||
New chat Able
正在加载,请稍候...