SPARC Recombinant monoclonal antibody

SPARC Uni-rAb® Recombinant Antibody for WB, IHC, ELISA
Cat No. 84621-3-RR
Clone No.241952E11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

241952E11, Basement membrane protein 40, Basement-membrane protein 40, BM 40, BM-40

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman testis tissue, human placenta tissue, A375 cells
Positive IHC detected inhuman stomach cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84621-3-RR targets SPARC in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1169

Product name: Recombinant Human SPARC protein (His Tag) (HPLC verified)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-10*His

Domain: 18-303 aa of NM_003118.4

Sequence: APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI

Predict reactive species
Full Name secreted protein, acidic, cysteine-rich (osteonectin)
Calculated Molecular Weight35kDa
Observed Molecular Weight40-43 kDa
GenBank Accession NumberNM_003118.4
Gene Symbol SPARC
Gene ID (NCBI) 6678
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP09486
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SPARC, also known as ON (Osteonectin) or BM-40 (Basement-membrane protein 40), is an extracellular glycoprotein with the calculated molecular mass of 35 kDa and the apparent molecular mass of 40-43 kDa and 50 kDa (PMID: 7495300, 12365801). SPARC belongs to a group of matricellular proteins defined as secreted components that do not contribute directly to the formation of structural elements but serve to modulate cell-matrix interactions and cellular functions (PMID: 7542656; 12231357). SPARC is expressed at high levels in bone tissue, is distributed widely in many other tissues and cell types, and is associated generally with tissues undergoing morphogenesis, remodeling and wound repair (PMID: 10567433). It elicits changes in cell shape, inhibits cell-cycle progression, and influences the synthesis of extracellular matrix (PMID: 12721366). Altered expression of SPARC has been reported in a variety of cancers, which include breast, ovarian, colorectal, and pancreatic cancer as well as melanoma and glioblastomas (PMID: 18849185).

Protocols

Product Specific Protocols
IHC protocol for SPARC antibody 84621-3-RRDownload protocol
WB protocol for SPARC antibody 84621-3-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...