VRK2 Recombinant monoclonal antibody

VRK2 Uni-rAb® Recombinant Antibody for WB, ELISA
Cat No. 84663-1-RR
Clone No.242180B2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Vaccinia-related kinase 2, vaccinia related kinase 2, Serine/threonine-protein kinase VRK2, EC:2.7.11.1, 242180B2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inU2OS cells, HepG2 cells, HEK-293T cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84663-1-RR targets VRK2 in WB, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag4019

Product name: Recombinant human VRK2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-353 aa of BC027854

Sequence: MPPKRNEKYKLPIPFPEGKVLDDMEGNQWVLGKKIGSGGFGLIYLAFPTNKPEKDARHVVKVEYQENGPLFSELKFYQRVAKKDCIKKWIERKQLDYLGIPLFYGSGLTEFKGRSYRFMVMERLGIDLQKISGQNGTFKKSTVLQLGIRMLDVLEYIHENEYVHGDVKAANLLLGYKNPDQVYLADYGLSYRYCPNGNHKQYQENPRKGHNGTIEFTSLDAHKGVALSRRSDVEILGYCMLRWLCGKLPWEQNLKDPVAVQTAKTNLLDELPQSVLKWAPSGSSCCEIAQFLVCAHSLAYDEKPNYQALKKILNPHGIPLGPLDFSTKGQSINVHTPNSQKVDSQKAATKQVN

Predict reactive species
Full Name vaccinia related kinase 2
Calculated Molecular Weight 508 aa, 58 kDa
Observed Molecular Weight 58 kDa
GenBank Accession NumberBC027854
Gene Symbol VRK2
Gene ID (NCBI) 7444
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ86Y07
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Vaccinia-related kinase 2 (VRK2) is a serine/threonine kinase that plays a significant role in various cellular processes, including cell survival, proliferation, and DNA damage response. The VRK2 gene is known to produce two main splice variants: VRK2A and VRK2B, with VRK2A being the predominant form in humans. VRK2 is involved in several key biological functions. It is known to enhance cell survival by acting as an anti-apoptotic factor, which is particularly crucial in cancer biology. The overexpression of VRK2 has been linked to increased drug sensitivity in cancer cells, suggesting that this kinase may play a role in therapeutic responses. Additionally, high levels of VRK2 protein have been associated with improved survival rates in specific subgroups of astrocytomas, a type of brain tumor. (PMID: 29872222; 37943248; 24079673)

Protocols

Product Specific Protocols
WB protocol for VRK2 antibody 84663-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...