Home
Products
Primary Antibodies
Recombinant Antibodies
Ly-6G Recombinant monoclonal antibody (84820-5-RR)

Ly-6G Recombinant monoclonal antibody

Ly-6G Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 84820-5-RR

Clone No. 260832C1

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IHC, ELISA

Synonyms

Ly6g, Ly 6G, Ly-6G.1

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHC

WB analysis using 84820-5-RR
Mouse bone marrow tissue were subjected to SDS PAGE followed by western blot with 84820-5-RR (Ly-6G antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. Ly-6G deficient cell lines C2C12 and NIH/3T3 were used as negative controls.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse spleen using 84820-5-RR
Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 84820-5-RR (Ly-6G antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse spleen using 84820-5-RR
Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 84820-5-RR (Ly-6G antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Ly-6G in ?

Overview

Tested Applications
Product Information
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	mouse bone marrow
Positive IHC detected in	mouse spleen tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:5000-1:50000
Immunohistochemistry (IHC)	IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84820-5-RR targets Ly-6G in WB, IHC, ELISA applications and shows reactivity with mouse samples.

Tested Reactivity	mouse
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Eg2609 Product name: Recombinant Mouse Ly-6G protein (rFc Tag) Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 21-114 aa of NM_001310438.1 Sequence: AERAQGLECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSS Predict reactive species
Full Name	lymphocyte antigen 6 complex, locus G
Calculated Molecular Weight	14 kDa
Observed Molecular Weight	20-30 kDa
GenBank Accession Number	NM_001310438.1
Gene Symbol	Ly-6G
Gene ID (NCBI)	546644
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	P35461
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ly-6G (lymphocyte antigen 6 complex, locus G), also known as Gr-1, is a glycosylphosphatidylinositol-anchored protein expressed on myeloid lineage cells in mouse bone marrow (PMID: 8360469). The expression of Ly-6G increases on neutrophils as they differentiate from immature cells in the bone marrow to mature cells in the blood and spleen (PMID: 8890901).